Главная страница » Приключения (Adventure) » Страница 231
Сортировать статьи по: дате | рейтингу | посещаемости | комментариям | алфавиту | размеру
Сортировать
Please The Gods 702 MB
Please The Gods
Готика 1 / Gothic 1 1.3 GB
Готика 1 / Gothic 1
Готика 3 / Gothic 3 3.5 GB
Готика 3 / Gothic 3
Сайлент Хилл 2 1.2 GB
Сайлент Хилл 2
Rayman Raving Rabbids 1 GB
Rayman Raving Rabbids
CHKN 2.2 GB
CHKN
LEGO Star Wars - The Complete Saga 4.4 GB
LEGO Star Wars - The Complete Saga
Thief of Thieves 4.3 GB
Thief of Thieves
VA-11 Hall-A Cyberpunk Bartender Action 292 MB
VA-11 Hall-A Cyberpunk Bartender Action
The Occupation 6.6 GB
The Occupation
We are the Plague 472 MB
We are the Plague
Bulb Boy 1.1 GB
Bulb Boy
Fhtagn! - Tales of the Creeping Madness 390 MB
Fhtagn! - Tales of the Creeping Madness
Jalopy 884 MB
Jalopy
VICCP 739 MB
VICCP
Brrrainz Feed your Hunger 1.1 GB
Brrrainz Feed your Hunger
Failed State 321 MB
Failed State
Riverbond 547 MB
Riverbond
Draw Rider 2 226 MB
Draw Rider 2
BE-A Walker 500 MB
BE-A Walker
Zombotron 794 MB
Zombotron
Jaws Of Extinction 28 GB
Jaws Of Extinction
SteamWorld Quest Hand of Gilgamesh 649 MB
SteamWorld Quest Hand of Gilgamesh
Rise of Ages 553 MB
Rise of Ages
Sid Meier's Pirates! 562 MB
Sid Meier's Pirates!
Regions Of Ruin 149 MB
Regions Of Ruin
Dead Rising 2 Off The Record 3.8 GB
Dead Rising 2 Off The Record
Velvet Assassin 3.8 GB
Velvet Assassin
MIND Path to Thalamus 1.5 GB
MIND Path to Thalamus
The Vanishing of Ethan Carter Redux 2.2 GB
The Vanishing of Ethan Carter Redux
Peter Jackson's King Kong The Official Game of the Movie 1.7 GB
Peter Jackson's King Kong The Official Game of the Movie
Late Shift 7.2 GB
Late Shift
Bayonetta 7.2 GB
Bayonetta
Irony Curtain From Matryoshka with Love 1.8 GB
Irony Curtain From Matryoshka with Love
Marvel Ultimate Alliance 2 4.9 GB
Marvel Ultimate Alliance 2
Psychonauts 2.9 GB
Psychonauts
Binary Domain 3.5 GB
Binary Domain
Hazardous space 1.2 GB
Hazardous space
Sniper Elite Nazi Zombie Army 2 2.5 GB
Sniper Elite Nazi Zombie Army 2
Rise of Insanity 3.1 GB
Rise of Insanity
Вперед Назад
1 ... 227 228 229 230 231 232 233 234 235 ... 239
Смотреть все игры
Часто ищут
call of dutysexgtasimulatorresident evilигры 2007need for speedfifaassassinstalkermetrosilent hillигры 2015battlefieldstar warscyberdoommafiawarhammerигры 2008warcrafttotal warfar crydark soulsmortal kombatfinal fantasytomb raiderspidermangod of warnfssniperhitmansimscrysisdiablo
Уже доступна!
Assassin's Creed Black Flag Resynced
Самое обсуждаемое
СТАЛКЕР 2 Сердце Чернобыля

СТАЛКЕР 2 Сердце Чернобыля
Marvel's Spidеr-Man 2

Marvel's Spidеr-Man 2
Ghost of Tsushimа DIRECTOR'S CUT

Ghost of Tsushimа DIRECTOR'S CUT
The Lаst оf Us Part 2 Remastered

The Lаst оf Us Part 2 Remastered
God of Wаr Ragnarok

God of Wаr Ragnarok
Resident Evil Rеquiem

Resident Evil Rеquiem
Crimson Desert

Crimson Desert
Hоrizon Forbidden West

Hоrizon Forbidden West
Copyright © 2014–2026 «Torrent-Igruha». Все права защищены. Копирование материалов и дизайна сайта без разрешения запрещено.
Сайт не аффилирован и не связан со Steam, Valve или другими правообладателями игр. Все товарные знаки и логотипы принадлежат их владельцам.
Контакты·Карта сайта·Наши проекты: Repack-Igruha.net